PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00127875001
Common NameGSBRNA2T00127875001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 341aa    MW: 36499.2 Da    PI: 9.7679
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00127875001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.11.9e-3891148461
               zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                            l+cprC+s+ntkfCy+nny+l+qPr+fCkaCrryWt+GGalrnvPvGgg+r+nkk+
  GSBRNA2T00127875001  91 GPLNCPRCNSANTKFCYFNNYNLTQPRHFCKACRRYWTQGGALRNVPVGGGCRRNKKA 148
                          5789***************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3374144IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3292147IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.58193147IPR003851Zinc finger, Dof-type
PROSITE patternPS01361095131IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MVFSSVSSFL DPPINWPQSA NSNNHPNHPH QLHPQETGNL VGGHRVHSHQ FPPQNPNPNH  60
NHVDTTVDPA GLSGSVTERA RLAKNSHPPE GPLNCPRCNS ANTKFCYFNN YNLTQPRHFC  120
KACRRYWTQG GALRNVPVGG GCRRNKKAKP GNSKSSASSQ NKQSTSMVNA PSPTTNSNIQ  180
LRTNSQLPFL PTLQNLTQLG GIGLNLAAIN GNSVGNGNTS SSFFNDLGFF HGANTSGPVM  240
ANNNNSESNI MTSLGSANHF AMLDRSMGLY SFPNEGNMVL SSSTASRVSQ TAPVKMEETH  300
VGSISRPDSG LSSAGNQSNQ YWPGLSLPGS SSNDQQQHLM *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.276820.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00127875001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013631774.10.0PREDICTED: dof zinc finger protein DOF2.2 isoform X1
SwissprotQ9ZV331e-169DOF22_ARATH; Dof zinc finger protein DOF2.2
TrEMBLA0A078CKF00.0A0A078CKF0_BRANA; BnaC04g40070D protein
STRINGBra035667.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.11e-143Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]